PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.6SI7V
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 398aa    MW: 44313.2 Da    PI: 8.3937
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.6SI7VgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.43.4e-3351105155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kprl+Wtp+LH+rF+eav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Araip.6SI7V  51 KPRLKWTPDLHARFIEAVHQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 105
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.81248108IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-3149106IPR009057Homeodomain-like
SuperFamilySSF466893.23E-1650106IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-2351106IPR006447Myb domain, plants
PfamPF002497.8E-1053104IPR001005SANT/Myb domain
PfamPF143792.1E-23163209IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
GGRMYHHHHQ GKNIHSSSSR MAMSSERHMF LQAAGNGSGG DSGLVLSTDA KPRLKWTPDL  60
HARFIEAVHQ LGGADKATPK TVMKLMGIPG LTLYHLKSHL QKYRLSKNLQ GQSNNNVPHK  120
ISASSVSTGE RPSESNGTHN HMNNNTLNTI PSSPQSSNNK DLHISEALQM QIEVQRRLNE  180
QLEVQRHMQV RIEAQGKYLQ AVLEKAQETL GKQDLGVVGL EAAKVQLSEL VSKVSSQCLE  240
LQTNNNHLPN NNNNDCSMDS NSCLTSEQEN LRPFINGHHH KFMLERNTTT ATTNFLTPLG  300
SKNNNSNSAE RRSYVVERSP SNLSMSIGLE RETEAAMMMS NEKGSHHHHH HHHQDYTLPP  360
SSYFSAPRLD LNARDQDQSH EATAATCKQL DLNGFSWS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0935521e-64BT093552.1 Soybean clone JCVI-FLGm-24O19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016187575.10.0PREDICTED: putative two-component response regulator-like APRR6 isoform X2
TrEMBLA0A0B2R6R91e-157A0A0B2R6R9_GLYSO; Myb family transcription factor APL
TrEMBLI1LTV81e-157I1LTV8_SOYBN; Uncharacterized protein
STRINGGLYMA12G31020.11e-156(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38523163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.32e-92G2-like family protein